PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678329443
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family FAR1
Protein Properties Length: 537aa    MW: 60102.6 Da    PI: 7.3822
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678329443genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR173.83.6e-2365153291
       FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                 Y++YA+ vGF+vr+ k+++   ++++ ++t++Cskeg ++e+ ++  + + +r+etrtgC+a++  + +++g w+v++++  HnHe+ap
  678329443  65 LYCDYARAVGFNVRRGKQYYFMGTKRVRSKTYCCSKEGAKDEKADT-CSLSYKRPETRTGCRAMISFSCDDSGLWKVSRFSRAHNHEMAP 153
                69***************************************99988.99999***********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.0E-1965153IPR004330FAR1 DNA binding domain
PfamPF043676.5E-30377477IPR007462Protein of unknown function DUF502
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010222Biological Processstem vascular tissue pattern formation
GO:0005794Cellular ComponentGolgi apparatus
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MESSGLDLEN QEALCGESDE DGGLNPRSGG EVVDVNGVQD DAHILHLEKR LLKKPVYSEE  60
EAYMLYCDYA RAVGFNVRRG KQYYFMGTKR VRSKTYCCSK EGAKDEKADT CSLSYKRPET  120
RTGCRAMISF SCDDSGLWKV SRFSRAHNHE MAPPYANPSV KSGQAILAAN VYGNGGSLES  180
LSEHEKIREL SIQLALAKNR AETFEKQAAA YKRQLHLIVD HIEEHNQFLS KRIQKVLGNR  240
FGVVRKTLIE FCSVEILEWE VVLLKKNLRV SMASTSGERD LELLIPVAEH RHGESDSVSD  300
SSKPSISASS QQNSGSETFY KLVRSWASKK FMTGCVILFP IAITFYITWW FIHFVDGFFS  360
PLYAQLGVDV FGVGFITSIT FIFLVGVFMS SWLGASLLSL GEWFIKRMPF VRHIYNASKQ  420
ISSAISPDQN TKAFKEVAII RHPRVGEYAF GFITSSLSLQ TNLGDEDLCC VYVPTNHLYI  480
GDIFLVNAKD VIRPNLSVRE GIEIVVSGGM SMPQILTTLH PTTILADDGI RSNTSRH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9QYP61e-144A0A0K9QYP6_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.25e-22FAR1 family protein